DFB13_MOUSE   Q8R2I4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R2I4

Recommended name:Beta-defensin 13

EC number:

Alternative names:(BD-13) (mBD-13) (Defensin, beta 13)

Cleaved into:

GeneID:246083

Gene names  (primary ):Defb13

Gene names  (synonym ):

Gene names  (ORF ):

Length:64

Mass:7520

Sequence:MRIFSLIVAGLVLLIQLYPAWGTLYRRFLCKKMNGQCEAECFTFEQKIGTCQANFLCCRKRKEH

Tissue specificity:Expressed in testis and to a lesser extent in epididymis (caput, corpus and cauda). Also weakly expressed in kidneys. {ECO:0000269|PubMed:12644567, ECO:0000269|PubMed:14718547}.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp