DFB12_MOUSE   Q8K4N3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K4N3

Recommended name:Beta-defensin 12

EC number:

Alternative names:(BD-12) (mBD-12) (Defensin, beta 12)

Cleaved into:

GeneID:77674

Gene names  (primary ):Defb12

Gene names  (synonym ):

Gene names  (ORF ):

Length:78

Mass:8872

Sequence:MALSREVFYFGFALFFIVVELPSGSWAGLEYSQSFPGGEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI

Tissue specificity:Only expressed in epididymis (caput, corpus and cauda). {ECO:0000269|PubMed:14718547}.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp