DFB10_MOUSE Q8R2I8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R2I8
Recommended name：Beta-defensin 10
EC number：
Alternative names：(BD-10) (mBD-10) (Defensin, beta 10)
Cleaved into：
GeneID：246085
Gene names (primary )：Defb10
Gene names (synonym )：
Gene names (ORF )：
Length：73
Mass：8393
Sequence：MRTLCSLLLICCLLFSYTTPAVGDLKHLILKAQLTRCYKFGGFCHYNICPGNSRFMSNCHPENLRCCKNIKQF
Tissue specificity：Expressed in both adult and neonate brain, and very weakly in kidneys, epididymis, and testis. {ECO:0000269|PubMed:12644567}.
Induction：
Developmental stage：
Protein families：Beta-defensin family