FER3L_MOUSE Q923Z4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q923Z4
Recommended name：Fer3-like protein
EC number：
Alternative names：(Basic helix-loop-helix protein N-twist) (Nephew of atonal 3) (Neuronal twist)
Cleaved into：
GeneID：114712
Gene names (primary )：Ferd3l
Gene names (synonym )：Nato Ntwist
Gene names (ORF )：
Length：168
Mass：19463
Sequence：MAAYPESCLDATVLNFVADLSLASPRHPLLCEFPPGVPFGDRTLGYREGRPGRLSQFDERYQEVEGDEVEYEDPEEEEEEGEGRGRVASLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEEKEAS
Tissue specificity：Detected in the developing central nervous system, in particular in embryonic ventral neural tube, brain, and spinal cord. Detected in embryonic intestine. Detected in embryonic and adult thalamus, hypothalamus, midbrain, pons and medulla. {ECO:0000269|PubMed:11472856, ECO:0000269|PubMed:12217327}.
Induction：
Developmental stage：
Protein families：