BI2L2_MOUSE   Q80Y61


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80Y61

Recommended name:Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2

EC number:

Alternative names:(BAI1-associated protein 2-like protein 2) (Planar intestinal- and kidney-specific BAR domain protein) (Pinkbar)

Cleaved into:

GeneID:207495

Gene names  (primary ):Baiap2l2

Gene names  (synonym ):

Gene names  (ORF ):

Length:522

Mass:58402

Sequence:MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGEQALQSSTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGDLLQHMEKNTKLDMQFIKDSCQHYEIEYRHRAANLEKCMSELWRMERKRDKNAREMKESVNRLHAQMQAFVSESKRAAELEEKRRYRFLAEKHLLLSNTFLQFLGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTRLDMPPRPLGEYGSPRSRHGSGSYGPEPAEARSASQLEPDRRSLPRTPSASSLYASSTQRSRSNSFGERLGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKPVEEIPVNPMNPVAPMNSMAPMSPMNELPSRSYPLRGSHSLDDLLDRPGNPTASSEYWDSQSRSRTPSRVPSRAPSPAPPPLPSSRRSSVGSMGAATDVKKLMSWEQNPPELFPRGTNPFATVKLRPTVTNDRSAPLIR

Tissue specificity:Expressed in the epithelial layer of the intestine and in the kidney. {ECO:0000269|PubMed:21743456}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp