CXL13_MOUSE O55038
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55038
Recommended name：C-X-C motif chemokine 13
EC number：
Alternative names：(B lymphocyte chemoattractant) (CXC chemokine BLC) (Small-inducible cytokine B13)
Cleaved into：
GeneID：55985
Gene names (primary )：Cxcl13
Gene names (synonym )：Blc Scyb13
Gene names (ORF )：
Length：109
Mass：11927
Sequence：MRLSTATLLLLLASCLSPGHGILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Tissue specificity：Found in spleen (B-cell-rich zone or follicles), Peyer patches (strongest within germinal centers and extending to the mantle zone) and lymph nodes (in reticular pattern in follicles).
Induction：
Developmental stage：
Protein families：Intercrine alpha (chemokine CxC) family