SERC1_MOUSE Q9QZI8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZI8
Recommended name：Serine incorporator 1
EC number：
Alternative names：(Axotomy-induced glyco/Golgi protein 2) (Membrane protein TMS-2) (Tumor differentially expressed protein 1-like) (Tumor differentially expressed protein 2)
Cleaved into：
GeneID：56442
Gene names (primary )：Serinc1
Gene names (synonym )：Aigp2 Tde1l Tde2 Tms2
Gene names (ORF )：
Length：453
Mass：50509
Sequence：MGSVLGLCSVASWIPCLCGSAPCLLCRCCPSGNNSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPGFCENEKGVVPCNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGTFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSLVAVVLFFVYYTHPASCAENKAFISVNMLLCIGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPETNCNPSLLSIIGFNTTRPIPKDGQSVQWWHPQGIIGLVLFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIEDGNGRSDGSLDDGDGIHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQWTAVWVKISSSWIGLVLYVWTLVAPLVLTNRDFD
Tissue specificity：Highly expressed in the neuronal populations such as Purkinje cells in the cerebellum, brainstem and spinal motor neurons, locus coeruleus and raphe nuclei.
Induction：
Developmental stage：
Protein families：TDE1 family