GRAA_MOUSE   P11032


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P11032

Recommended name:Granzyme A

EC number:EC 3.4.21.78

Alternative names:(Autocrine thymic lymphoma granzyme-like serine protease) (CTLA-3) (Fragmentin-1) (T cell-specific serine protease 1) (TSP-1)

Cleaved into:

GeneID:14938

Gene names  (primary ):Gzma

Gene names  (synonym ):Ctla-3 Ctla3 Mtsp-1

Gene names  (ORF ):

Length:260

Mass:28599

Sequence:MRNASGPRGPSLATLLFLLLIPEGGCERIIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Tissue specificity:Found in cytotoxic lymphocytes and in normal lymphoid tissues such as thymus and spleen. {ECO:0000269|PubMed:1460043}.; [Isoform HF1]: More abundant in lymphoid tissues than isoform HF2. {ECO:0000269|PubMed:1460043}.

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Granzyme subfamily


   💬 WhatsApp