FBX32_MOUSE   Q9CPU7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CPU7

Recommended name:F-box only protein 32

EC number:

Alternative names:(Atrogin-1) (Muscle atrophy F-box protein) (MAFbx)

Cleaved into:

GeneID:67731

Gene names  (primary ):Fbxo32

Gene names  (synonym ):

Gene names  (ORF ):

Length:355

Mass:41504

Sequence:MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYSKENLFSSLNYDVAAKKRKKDIQNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNSIQISRPAFKGLTITDLPVCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKRLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

Tissue specificity:Specifically expressed in cardiac and skeletal muscle.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp