ATP5J_MOUSE   P97450


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97450

Recommended name:ATP synthase-coupling factor 6, mitochondrial

EC number:

Alternative names:(ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)

Cleaved into:

GeneID:11957

Gene names  (primary ):Atp5pf

Gene names  (synonym ):Atp5j

Gene names  (ORF ):

Length:108

Mass:12496

Sequence:MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGPVDIGPEYQQDLDRELYKLKQMYGKGEMDTFPTFKFDDPKFEVIDKPQS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Eukaryotic ATPase subunit F6 family


   💬 WhatsApp