AT5F1_MOUSE   Q9CQQ7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQQ7

Recommended name:ATP synthase F(0) complex subunit B1, mitochondrial

EC number:

Alternative names:(ATP synthase peripheral stalk-membrane subunit b) (ATP synthase subunit b) (ATPase subunit b)

Cleaved into:

GeneID:11950

Gene names  (primary ):Atp5pb

Gene names  (synonym ):Atp5f1

Gene names  (ORF ):

Length:256

Mass:28949

Sequence:MLSRVVLSAAATAAPCLKNAAALGPGVLQATRAFHTGQPRLAPLPPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYGASFGEFIDKLNEEKIAQLEEVKQSSMKQIQDAIDMEKAQQALVQKRHYLFDVQRNNIALALEVTYRERLHKAYKEVKNRLDYHISVQNMMRRKEEEHMIDWVEKHVVKSISVQQEKETIAKCIEDLKLLAKKAQAQPIM

Tissue specificity:

Induction:

Developmental stage:

Protein families:Eukaryotic ATPase B chain family


   💬 WhatsApp