AT5G3_MOUSE P56384
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56384
Recommended name：ATP synthase F(0) complex subunit C3, mitochondrial
EC number：
Alternative names：(ATP synthase lipid-binding protein) (ATP synthase membrane subunit c locus 3) (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c)
Cleaved into：
GeneID：228033
Gene names (primary )：Atp5mc3
Gene names (synonym )：Atp5g3
Gene names (ORF )：
Length：141
Mass：14745
Sequence：MFACAKLARTPALIRAGSRVAYRPISASVLSRPETRTGEGSTVFNGAQNGVCQLIRREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Tissue specificity：
Induction：
Developmental stage：
Protein families：ATPase C chain family