ASGL1_MOUSE Q8C0M9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C0M9
Recommended name：Isoaspartyl peptidase/L-asparaginase
EC number：EC 3.4.19.5
Alternative names：(Asparaginase-like protein 1) (Beta-aspartyl-peptidase) (Isoaspartyl dipeptidase) (L-asparagine amidohydrolase)
Cleaved into：Isoaspartyl peptidase/L-asparaginase alpha chain; Isoaspartyl peptidase/L-asparaginase beta chain
GeneID：66514
Gene names (primary )：Asrgl1
Gene names (synonym )：
Gene names (ORF )：
Length：326
Mass：33950
Sequence：MACARGTVAPPVRASIDVSLVVVVHGGGASNISANRKELVREGIARAATEGYKILKAGGSAVDAVEGAVTVLENDPEFNAGYGSVLNVNGDIEMDASIMDGKDLSAGAVSAVRCIANPVKLARLVMEKTPHCFLTGHGAEKFAEDMGIPQVPVEKLITERTKKHLEKEKLEKGAQNADCPKNSGTVGAVALDCRGNLAYATSTGGIVNKMVGRVGDSPCIGAGGYADNNLGAVSTTGHGESILKVNLARLALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASMPWAAVKNGKLQAGIDLCETRTRDLPC
Tissue specificity：High expression in the heart and brain while low to minimal expresion in the other tissues. In ocular tissues, high levels is observed in the optic nerve and retina while relatively low levels of expression are detected in the iris-ciliary body, lens or retinal pigment epithelium. {ECO:0000269|PubMed:27106100}.
Induction：
Developmental stage：
Protein families：Ntn-hydrolase family