AR6P4_MOUSE   Q9JM93


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JM93

Recommended name:ADP-ribosylation factor-like protein 6-interacting protein 4

EC number:

Alternative names:(ARL-6-interacting protein 4) (Aip-4) (Splicing factor SRrp37)

Cleaved into:

GeneID:65105

Gene names  (primary ):Arl6ip4

Gene names  (synonym ):

Gene names  (ORF ):

Length:229

Mass:25525

Sequence:MAHVGSRKRSRSRSRSRSGRRGSEKRSKRSSKDASRNCSASRSQGHKAGSASGVEERSKHKAQRTSRSSSTSSSSSSSSSASSSSSSDGRKKRAKHKEKKRKKKKKKRKKKLKKRVKEKAVAVHQAEALPGPSLDQWHRSAGEDNDGPVLTDEQKSRIQAMKPMTKEEWDARQSVIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDGLAFQMRTGLLP

Tissue specificity:Widely expressed. Expressed at high level in testis and thymus. {ECO:0000269|PubMed:10708573}.

Induction:

Developmental stage:

Protein families:ARL6IP4 family


   💬 WhatsApp