MIP_MOUSE   P51180


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51180

Recommended name:Lens fiber major intrinsic protein

EC number:

Alternative names:(Aquaporin-0) (MIP26) (MP26)

Cleaved into:

GeneID:17339

Gene names  (primary ):Mip

Gene names  (synonym ):Palm

Gene names  (ORF ):

Length:263

Mass:28193

Sequence:MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQTVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHAGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFSNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGARPSDSNGQPEGTGEPVELKTQAL

Tissue specificity:Major component of lens fiber gap junctions.

Induction:

Developmental stage:

Protein families:MIP/aquaporin (TC 1.A.8) family


   💬 WhatsApp