AQP1_MOUSE Q02013
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q02013
Recommended name：Aquaporin-1
EC number：
Alternative names：(AQP-1) (Aquaporin-CHIP) (Delayed early response protein 2) (DER2) (Water channel protein for red blood cells and kidney proximal tubule)
Cleaved into：
GeneID：11826
Gene names (primary )：Aqp1
Gene names (synonym )：
Gene names (ORF )：
Length：269
Mass：28793
Sequence：MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDNSLGRNDLAHGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDFTDRMKVWTSGQVEEYDLDADDINSRVEMKPK
Tissue specificity：Detected in erythrocytes (at protein level) (PubMed:12133842). In the kidney, expressed on luminal and basal borders of proximal tubules and in the thin limb of Henle's loop (at protein level) (PubMed:31605441). {ECO:0000269|PubMed:12133842, ECO:0000269|PubMed:31605441}.
Induction：
Developmental stage：
Protein families：MIP/aquaporin (TC 1.A.8) family