BIK_MOUSE   O70337


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70337

Recommended name:Bcl-2-interacting killer

EC number:

Alternative names:(Apoptosis inducer NBK) (Bik-like killer protein)

Cleaved into:

GeneID:12124

Gene names  (primary ):Bik

Gene names  (synonym ):Biklk Blk Nbk

Gene names  (ORF ):

Length:150

Mass:16901

Sequence:MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ

Tissue specificity:Expressed in testis, kidney, liver, lung and heart. {ECO:0000269|PubMed:9525867}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp