ABEC1_MOUSE   P51908


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51908

Recommended name:C->U-editing enzyme APOBEC-1

EC number:EC 3.5.4.36

Alternative names:(Apolipoprotein B mRNA-editing enzyme 1) (mRNA(cytosine(6666)) deaminase 1)

Cleaved into:

GeneID:11810

Gene names  (primary ):Apobec1

Gene names  (synonym ):

Gene names  (ORF ):

Length:229

Mass:27522

Sequence:MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSVWRHTSQNTSNHVEVNFLEKFTTERYFRPNTRCSITWFLSWSPCGECSRAITEFLSRHPYVTLFIYIARLYHHTDQRNRQGLRDLISSGVTIQIMTEQEYCYCWRNFVNYPPSNEAYWPRYPHLWVKLYVLELYCIILGLPPCLKILRRKQPQLTFFTITLQTCHYQRIPPHLLWATGLK

Tissue specificity:Expressed in the spleen. Expressed at lower level in the kidney, testis, lung, brain and liver. {ECO:0000269|PubMed:12859895}.

Induction:

Developmental stage:

Protein families:Cytidine and deoxycytidylate deaminase family


   💬 WhatsApp