APOC4_MOUSE   Q61268


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61268

Recommended name:Apolipoprotein C-IV

EC number:

Alternative names:(Apo-CIV) (ApoC-IV) (Apolipoprotein C2-linked) (ACL) (Apolipoprotein C4)

Cleaved into:

GeneID:11425

Gene names  (primary ):Apoc4

Gene names  (synonym ):Acl

Gene names  (ORF ):

Length:124

Mass:14288

Sequence:MSLLRCRPRDLPSVSLSVLFLVSFVASMSTESLSPTPGPESSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQGFMQTYYEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCKDRTQG

Tissue specificity:Expressed by the liver and secreted in plasma.

Induction:

Developmental stage:

Protein families:Apolipoprotein C4 family


   💬 WhatsApp