APOC2_MOUSE   Q05020


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q05020

Recommended name:Apolipoprotein C-II

EC number:

Alternative names:(Apo-CII) (ApoC-II) (Apolipoprotein C2)

Cleaved into:

GeneID:105886299

Gene names  (primary ):Apoc2

Gene names  (synonym ):

Gene names  (ORF ):

Length:97

Mass:10741

Sequence:MGSRFFLALFLVILMLGNEVQGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE

Tissue specificity:Adult and fetal liver, intestine and peritoneal macrophages. {ECO:0000269|PubMed:7691714}.

Induction:

Developmental stage:

Protein families:Apolipoprotein C2 family


   💬 WhatsApp