APOA1_MOUSE   Q00623


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00623

Recommended name:Apolipoprotein A-I

EC number:

Alternative names:(Apo-AI) (ApoA-I) (Apolipoprotein A1)

Cleaved into:Proapolipoprotein A-I (ProapoA-I); Truncated apolipoprotein A-I

GeneID:11806

Gene names  (primary ):Apoa1

Gene names  (synonym ):

Gene names  (ORF ):

Length:264

Mass:30616

Sequence:MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ

Tissue specificity:Major protein of plasma HDL, also found in chylomicrons.

Induction:

Developmental stage:

Protein families:Apolipoprotein A1/A4/E family


   💬 WhatsApp