ODAM_MOUSE   A1E960


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A1E960

Recommended name:Odontogenic ameloblast-associated protein

EC number:

Alternative names:(Apin)

Cleaved into:

GeneID:69592

Gene names  (primary ):Odam

Gene names  (synonym ):Apin

Gene names  (ORF ):

Length:273

Mass:29820

Sequence:MKIIILLGLIGASSSAPLISQRLLSASNSHELLLNLNNGQLLPLQFQGAFNSWIPPFPGFLQQQQAQVSGRPQFTLSTLESFAGLFPNQIPLSRQVGLAQGGQAGQPDLSQQQTPPQTQQSASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQTVTSSPQHTGQQLFEEQIPFYNQFGFAPPQAEPGVPGGQQHLAFDSFVGTAPETPGMPVEGSLLYPQKEPISFKHDNAGVFMPTTSPKPSTDNFFTSGIDPTIAPEQKVKTDSLREP

Tissue specificity:Highly expressed in tooth-associated epithelia. Predominantly expressed in mandible. {ECO:0000269|PubMed:17647262}.

Induction:

Developmental stage:

Protein families:ODAM family


   💬 WhatsApp