APEX1_MOUSE P28352
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28352
Recommended name：DNA-(apurinic or apyrimidinic site) endonuclease
EC number：EC 3.1.-.-
Alternative names：(APEX nuclease) (APEN) (Apurinic-apyrimidinic endonuclease 1) (AP endonuclease 1) (REF-1) (Redox factor-1)
Cleaved into：DNA-(apurinic or apyrimidinic site) endonuclease, mitochondrial
GeneID：11792
Gene names (primary )：Apex1
Gene names (synonym )：Ape Apex Ref1
Gene names (ORF )：
Length：317
Mass：35490
Sequence：MPKRGKKAAADDGEEPKSEPETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Tissue specificity：Expressed in both resting and stimulated B cells stimulated to switch (at protein level).
Induction：
Developmental stage：
Protein families：DNA repair enzymes AP/ExoA family