FHIT_MOUSE   O89106


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O89106

Recommended name:Bis(5'-adenosyl)-triphosphatase

EC number:EC 3.6.1.29

Alternative names:(AP3A hydrolase) (AP3Aase) (Diadenosine 5',5'''-P1,P3-triphosphate hydrolase) (Dinucleosidetriphosphatase) (Fragile histidine triad protein)

Cleaved into:

GeneID:14198

Gene names  (primary ):Fhit

Gene names  (synonym ):

Gene names  (ORF ):

Length:150

Mass:17235

Sequence:MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA

Tissue specificity:Expressed in heart, brain, lung and skeletal muscle. Particularly strong expression in liver, testis and kidney, where it is confined to the tubular epithelium. {ECO:0000269|PubMed:9671749, ECO:0000269|PubMed:9699672}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp