ANGL6_MOUSE   Q8R0Z6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R0Z6

Recommended name:Angiopoietin-related protein 6

EC number:

Alternative names:(Angiopoietin-like protein 6) (Angiopoietin-related growth factor)

Cleaved into:

GeneID:70726

Gene names  (primary ):Angptl6

Gene names  (synonym ):Agf

Gene names  (ORF ):

Length:457

Mass:51095

Sequence:MGTARLRKLQLLLLLGAWRALGGAARCRVTLVLSPQKATSAVCRSSEATQDSELATLRMRLGRHEELLRALQRRAAEGGALADEVRALREHSLTLNTRLGQLRAQLQQEARAEPDLGAEPAAALGLLAERALDAEAEARRTTARLQQLDAQLREHAQLMSQHSSLLGRLQRACAGPERGQQQVLPLPLAPLVPLSLVGSASNTSRRLDQTPEHQREQSLRQQGPPSSLLPTGHLAVPTRPVGPWRDCAEAHGAGHWQSGVYDLRLGRRVVAVWCEQQQEGGGWTVIQRRQDGSVNFFTNWQHYKAGFGRPEGEYWLGLEPVHQVTSRGDHELLILLEDWGGRAARAHYDSFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYHRGGWWYHACAHSNLNGVWYHGGHYRSRYQDGVYWAEFRGGAYSLKKAVMLTRLVRL

Tissue specificity:Highly expressed in the liver, specifically in hepatocytes, and weakly in the heart. Expressed in hematopoietic cells, platelets and mast cells, and detected at wounded skin. {ECO:0000269|PubMed:12871997}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp