NECA3_MOUSE   Q9D6J4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D6J4

Recommended name:N-terminal EF-hand calcium-binding protein 3

EC number:

Alternative names:(Amyloid-beta A4 protein-binding family A member 2-binding protein) (X11L-binding protein 51) (mXB51)

Cleaved into:

GeneID:56846

Gene names  (primary ):Necab3

Gene names  (synonym ):Apba2bp Xb51

Gene names  (ORF ):

Length:353

Mass:39906

Sequence:MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDGKLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAALESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLEAQAHGQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQVNRLQELIDQLECKAPRLEPTHEEDLTKGFDSHILVAQRQVQVAEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAFTLYEFWQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN

Tissue specificity:Widely expressed, with highest levels in the brain. {ECO:0000269|PubMed:14697346}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp