STALP_MOUSE   Q76N33


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q76N33

Recommended name:AMSH-like protease

EC number:EC 3.4.19.-

Alternative names:(AMSH-LP) (AMSH family protein) (AMSH-FP) (STAM-binding protein-like 1)

Cleaved into:

GeneID:76630

Gene names  (primary ):Stambpl1

Gene names  (synonym ):Amshlp

Gene names  (ORF ):

Length:436

Mass:49640

Sequence:MEQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNISINEDITPRRYFRSGVEMERMASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKTDLLRKYNIEYQEYLQSKNKYKAEILKKLEHQRLIEAERQRIAQMRQQQLESEQFLFFEDQLKKQELARGQIRGQDSPVLSEQTDGSALSCFSTHQSNSLRNAFADHPHKSDGSNFANYSPPVNRALKPAATLSAVQNLVVEGLRCVVLSRDLCHKFLLLADSNTVRGIETCGILCGKLTHNEFTITHVVVPKQSAGPDYCDVENVEELFNVQDQHGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSTCKKKGFHPHTKDPKLFSICSHVLVKDIKTTVLDLR

Tissue specificity:Ubiquitously expressed. Isoform 1 is widely expressed while isoform 2 is testis-specific. {ECO:0000269|PubMed:12943674}.

Induction:

Developmental stage:

Protein families:Peptidase M67C family


   💬 WhatsApp