XCT_MOUSE Q9WTR6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTR6
Recommended name：Cystine/glutamate transporter
EC number：
Alternative names：(Amino acid transport system xc-) (Solute carrier family 7 member 11) (xCT)
Cleaved into：
GeneID：26570
Gene names (primary )：Slc7a11
Gene names (synonym )：
Gene names (ORF )：
Length：502
Mass：55456
Sequence：MVRKPVVATISKGGYLQGNMSGRLPSMGDQEPPGQEKVVLKKKITLLRGVSIIIGTVIGSGIFISPKGILQNTGSVGMSLVFWSACGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGPLLAFVRVWVELLVIRPGATAVISLAFGRYILEPFFIQCEIPELAIKLVTAVGITVVMVLNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELLQSSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPKWFRRLSDRITRTLQIILEVVPEDSKEL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family