CASA1_MOUSE   P19228


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P19228

Recommended name:Alpha-S1-casein

EC number:

Alternative names:(Alpha-casein)

Cleaved into:

GeneID:12990

Gene names  (primary ):Csn1s1

Gene names  (synonym ):Csn1 Csna

Gene names  (ORF ):

Length:313

Mass:35602

Sequence:MKLLILTCLVAAAFAMPRLHSRNAVSSQTQQQHSSSEEIFKQPKYLNLNQEFVNNMNRQRALLTEQNDEIKVTMDAASEEQAMASAQEDSSISSSSEESEEAIPNITEQKNIANEDMLNQCTLEQLQRQFKYNQLLQKASLAKQASLFQQPSLVQQASLFQQPSLLQQASLFQQPSMAQQASLLQQLLLAQQPSLALQVSPAQQSSLVQQAFLAQQASLAQKHHPRLSQSYYPHMEQPYRMNAYSQVQMRHPMSVVDQALAQFSVQPFPQIFQYDAFPLWAYFPQDMQYLTPKAVLNTFKPIVSKDTEKTNVW

Tissue specificity:Mammary gland specific. Secreted in milk.

Induction:

Developmental stage:

Protein families:Alpha-casein family


   💬 WhatsApp