ABHGB_MOUSE   Q80YU0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80YU0

Recommended name:Protein ABHD16B

EC number:EC 3.-.-.-

Alternative names:(Alpha/beta hydrolase domain-containing protein 16B) (Abhydrolase domain-containing protein 16B)

Cleaved into:

GeneID:241850

Gene names  (primary ):Abhd16b

Gene names  (synonym ):

Gene names  (ORF ):

Length:474

Mass:53297

Sequence:MCVICFVKALVHVFKIYLTANYSYNFRSWPVDFRWDDLHAPSTGNSSQRALTCAAAAAGVWLLHDAALGGDTLTRPPRGARSQVQCLLQQIRELPSQLASYALAHSLGRWLVYPGSMFLMTRALMPLLQQGQERLVDRYRGRRAKLVACDGNEIDTMFMDRRQHPGSHGRGLCLVICCEGNAGFYEMGCLSAPLEAGYSVLGWNHPGFGGSTGAPFPQHDANAMDVVVKYALHRLNFPPAHVVVYGWSIGGFTATWATMTYPELGALVLDATFDDLVPLALKVMPQSWKGLVVRTVREHFNLNVAEQLCCYPGPVLLLRRTQDDVVSTSNHIPSMPSCQVEGDVEGNRGNELLLRLLQHRYPSVMAREGRTVVTRWLRASNLAQETALYARYRVDDEWCLATLRSYRERCQKELDDAEAWGPHGLSFPWFVGQGLSARRRRQLALFLARRHLKNLEATHCSPLEPEDFQLPWRL

Tissue specificity:

Induction:

Developmental stage:

Protein families:AB hydrolase superfamily, ABHD16 family


   💬 WhatsApp