MILR1_MOUSE   Q3TB92


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3TB92

Recommended name:Allergin-1

EC number:

Alternative names:(Allergy inhibitory receptor 1) (Mast cell antigen 32) (MCA-32) (Mast cell Ag-32) (Mast cell immunoglobulin-like receptor 1)

Cleaved into:

GeneID:380732

Gene names  (primary ):Milr1

Gene names  (synonym ):Gm885 Mca32

Gene names  (ORF ):

Length:246

Mass:27366

Sequence:MGDGDSPMCLSAVSFKGIRCWLDKLLLWALTISITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLSLLLPGLLLGILVIVLVLAYLIHLKYKKGKKTQREDQSKGSGDAPAQDELYVNACKTQTEQPQEIHYATPVFKEMAPMEEEGGTDGKADYIYSELTH

Tissue specificity:Expressed in myeloid cells (dendritic cells, macrophages and neutrophils but not in T-cells, B-cells or natural killer cells) and mast cells (at protein level). {ECO:0000269|PubMed:20526344}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp