S2B20_MOUSE Q9JI02
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JI02
Recommended name：Secretoglobin family 2B member 20
EC number：
Alternative names：(Allergen dI chain C2C) (Androgen-binding protein delta) (Lacrimal androgen-binding protein delta)
Cleaved into：
GeneID：
Gene names (primary )：Scgb2b20
Gene names (synonym )：Abpd
Gene names (ORF )：
Length：112
Mass：12590
Sequence：MKGTLLLLGLLVTGELSFQTTEACLPFFEGYASVLSGSRVWLYQELQAFNATAEEKVALEKIQDCFSEERIRNILLEPKIMEAMVASPECLSYYGLDNIRSILDYISKLLGE
Tissue specificity：Expressed in lacrimal gland, at higher level in males than females. Expressed in the submandibular gland. {ECO:0000269|PubMed:15623751}.
Induction：
Developmental stage：
Protein families：Secretoglobin family