S2B24_MOUSE Q7M747
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7M747
Recommended name：Secretoglobin family 2B member 24
EC number：
Alternative names：(Allergen dI chain C2B) (Androgen-binding protein zeta) (Lacrimal androgen-binding protein zeta)
Cleaved into：
GeneID：233090
Gene names (primary )：Scgb2b24
Gene names (synonym )：Abpz
Gene names (ORF )：
Length：112
Mass：12535
Sequence：MKGTLLLLALLMIGELGFHTTEACVPFFAGYAGVISGSRLWLYHELSAFNGTPKETVAYEKIQDCYKEQGVKSQTLEPQILASILVTPECLQYYSEETFTKIKDALKKISQH
Tissue specificity：Expressed in lacrimal gland, at higher level in males than females. {ECO:0000269|PubMed:15623751}.
Induction：
Developmental stage：
Protein families：Secretoglobin family