ACER1_MOUSE   Q8R4X1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R4X1

Recommended name:Alkaline ceramidase 1

EC number:EC 3.5.1.-

Alternative names:(AlkCDase 1) (Alkaline CDase 1) (maCER1) (Acylsphingosine deacylase 3) (N-acylsphingosine amidohydrolase 3)

Cleaved into:

GeneID:171168

Gene names  (primary ):Acer1

Gene names  (synonym ):Asah3

Gene names  (ORF ):

Length:273

Mass:32082

Sequence:MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPYAQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPKFVKGNRFYFSCLVTITTIISTFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRHLIAVSVVLWAAALTSWISDRVLCSFWQRIHFYYLHSIWHVLISITFPYGIVTMALVDAKYEMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC

Tissue specificity:Highly expressed in skin. Weakly or not expressed in other tissues (PubMed:12783875). Expressed by granular layer of interfollicular epidermis, sebaceous glands and infundibulum (PubMed:29056331). {ECO:0000269|PubMed:12783875, ECO:0000269|PubMed:29056331}.

Induction:

Developmental stage:

Protein families:Alkaline ceramidase family


   💬 WhatsApp