PDCD6_MOUSE   P12815


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P12815

Recommended name:Programmed cell death protein 6

EC number:

Alternative names:(ALG-257) (Apoptosis-linked gene 2 protein) (ALG-2) (PMP41)

Cleaved into:

GeneID:18570

Gene names  (primary ):Pdcd6

Gene names  (synonym ):Alg2

Gene names  (ORF ):

Length:191

Mass:21867

Sequence:MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp