AKA7G_MOUSE Q7TN79
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TN79
Recommended name：A-kinase anchor protein 7 isoform gamma
EC number：
Alternative names：(AKAP-7 isoform gamma) (A-kinase anchor protein 18) (AKAP-18) (Protein kinase A-anchoring protein 7 isoform gamma) (PRKA7 isoform gamma)
Cleaved into：
GeneID：432442
Gene names (primary )：Akap7
Gene names (synonym )：Akap18
Gene names (ORF )：
Length：314
Mass：35482
Sequence：MPFAAVDIQDDCGSPDVPQANPKRSKEEEEDRGDKNDHVKKRKKAKKDYQPNYFLSIPITNKKITTGIKVLQNSILQQDKRLTKAMVGDGSFHITLLVMQLLNEDEVNIGTDALLELKPFVEEILEGKHLALPFQGIGTFQGQVGFVKLADGDHVSALLEIAETAKRTFREKGILAGESRTFKPHLTFMKLSKAPMLRKKGVRKIEPGLYEQFIDHRFGEELLYQIDLCSMLKKKQSNGYYHCESSIVIGEKDRREPEDAELVRLSKRLVENAVLKAVQQYLEETQNKKQPGEGNSTKAEEGDRNGDGSDNNRK
Tissue specificity：Expressed in oocytes. {ECO:0000269|PubMed:12804576}.
Induction：
Developmental stage：
Protein families：