AKA7A_MOUSE O55074
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55074
Recommended name：A-kinase anchor protein 7 isoform alpha
EC number：
Alternative names：(AKAP-7 isoform alpha) (A-kinase anchor protein 18) (AKAP-18) (A-kinase anchor protein 9 kDa) (AKAP 9) (Protein kinase A-anchoring protein 7 isoform alpha) (PRKA7 isoform alpha)
Cleaved into：
GeneID：432442
Gene names (primary )：Akap7
Gene names (synonym )：Akap18
Gene names (ORF )：
Length：81
Mass：9169
Sequence：MGQLCCFPFARDEGKICEKDRREPEDAELVRLSKRLVENAVLKAVQQYLEETQNKKQPGEGNSTKAEEGDRNGDGSDNNRK
Tissue specificity：
Induction：
Developmental stage：
Protein families：