AIF1_MOUSE   O70200


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70200

Recommended name:Allograft inflammatory factor 1

EC number:

Alternative names:(AIF-1) (Ionized calcium-binding adapter molecule 1)

Cleaved into:

GeneID:11629

Gene names  (primary ):Aif1

Gene names  (synonym ):Iba1

Gene names  (ORF ):

Length:147

Mass:16911

Sequence:MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Tissue specificity:Abundantly expressed in the testis, moderately in the spleen and lymph nodes and at low levels in the liver and thymus. Detected in macrophages. {ECO:0000269|PubMed:11722645}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp