BST1_MOUSE   Q64277


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64277

Recommended name:ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2

EC number:EC 3.2.2.6

Alternative names:(ADP-ribosyl cyclase 2) (Antigen BP3) (BP-3 alloantigen) (Bone marrow stromal antigen 1) (BST-1) (Cyclic ADP-ribose hydrolase 2) (cADPr hydrolase 2) (Leukocyte antigen 65) (Ly-65) (CD antigen CD157)

Cleaved into:

GeneID:12182

Gene names  (primary ):Bst1

Gene names  (synonym ):Bp-3 Bp3 Ly65

Gene names  (ORF ):

Length:311

Mass:34616

Sequence:MAVQGGLLSLWLWLWLSLLTVLLGARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRESASLHAIGDASLLISLLVALASSSQA

Tissue specificity:Expressed in the bone marrow, spleen and thymus in lymphoid organs, and the lung, kidney and heart in non-lymphoid organs.

Induction:

Developmental stage:

Protein families:ADP-ribosyl cyclase family


   💬 WhatsApp