DCAM1_MOUSE   P0DMN7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0DMN7

Recommended name:S-adenosylmethionine decarboxylase proenzyme 1

EC number:EC 4.1.1.50

Alternative names:(AdoMetDC 1) (SAMDC 1)

Cleaved into:S-adenosylmethionine decarboxylase 1 alpha chain; S-adenosylmethionine decarboxylase 1 beta chain

GeneID:11702

Gene names  (primary ):Amd1

Gene names  (synonym ):

Gene names  (ORF ):

Length:334

Mass:38272

Sequence:MEAAHFFEGTEKLLEVWFSRQQSDASQGSGDLRTIPRSEWDVLLKDVQCSIISVTKTDKQEAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATLFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLSSPQKIDGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS

Tissue specificity:Expressed in embryonic stem cells; subsequently down-regulated in differentiating neural precursor cells. {ECO:0000269|PubMed:22391449}.

Induction:

Developmental stage:

Protein families:Eukaryotic AdoMetDC family


   💬 WhatsApp