RETN_MOUSE   Q99P87


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99P87

Recommended name:Resistin

EC number:

Alternative names:(Adipose tissue-specific secretory factor) (ADSF) (Adipose-specific cysteine-rich secreted protein A12-alpha) (Cysteine-rich secreted protein FIZZ3)

Cleaved into:

GeneID:57264

Gene names  (primary ):Retn

Gene names  (synonym ):Fizz3

Gene names  (ORF ):

Length:114

Mass:12492

Sequence:MKNLSFPLLFLFFLVPELLGSSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Tissue specificity:Expressed in white but not brown adipose tissue in a variety of organs. {ECO:0000269|PubMed:11201732}.

Induction:

Developmental stage:

Protein families:Resistin/FIZZ family


   💬 WhatsApp