HINT1_MOUSE P70349
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70349
Recommended name:Histidine triad nucleotide-binding protein 1
EC number:EC 3.-.-.-
Alternative names:(Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)
Cleaved into:
GeneID:15254
Gene names (primary ):Hint1
Gene names (synonym ):Hint Pkci Pkci1 Prkcnh1
Gene names (ORF ):
Length:126
Mass:13777
Sequence:MADEIAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVADDDDESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG
Tissue specificity:
Induction:
Developmental stage:
Protein families:HINT family