GRAP2_MOUSE   O89100


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O89100

Recommended name:GRB2-related adaptor protein 2

EC number:

Alternative names:(Adapter protein GRID) (GADS protein) (GRB-2-like protein) (GRB2L) (GRB-2-related monocytic adapter protein) (MONA) (Monocytic adapter) (GRBLG) (Growth factor receptor-binding protein) (Hematopoietic cell-associated adaptor protein GrpL)

Cleaved into:

GeneID:17444

Gene names  (primary ):Grap2

Gene names  (synonym ):Gads Grb2l Grid Mona

Gene names  (ORF ):

Length:322

Mass:36810

Sequence:MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR

Tissue specificity:

Induction:

Developmental stage:

Protein families:GRB2/sem-5/DRK family


   💬 WhatsApp