S35G3_MOUSE Q5F297
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5F297
Recommended name：Solute carrier family 35 member G3
EC number：
Alternative names：(Acyl-malonyl-condensing enzyme 1)
Cleaved into：
GeneID：
Gene names (primary )：Slc35g3
Gene names (synonym )：Amac1
Gene names (ORF )：
Length：340
Mass：35573
Sequence：MAASHPYFNLPDFTQPSPPSTPASLPSKHHHRCGPSNATKGLFVALLGGGLSAGFVGPFSRMAYQTSQLPSLELLIFRCLFHLPIALLLKFRGDPLLGPPDVRVRAFLHAILNVLSIGCAYSAVQVVPAGNAVTVRKGSSTVCSALLALCLESQGLSGYAWCGLFGSTLGLIIIVGPGLGTLQEGTTGLYTALGYVLAFLGGLALSLGLQIYRSLHFPSCLPTVAFLFGLVGLMVSVPGLFVLQTPVLPQDTLSWSCVVAVGLLALVSFVCVSYAVTKAHPALVCAVLHSEVVVALMLQYYVLYETVAPSDIMGAGVVLGSIAIITAQNLSCDKEGQTEE
Tissue specificity：
Induction：
Developmental stage：
Protein families：SLC35G solute transporter family