MOGT1_MOUSE   Q91ZV4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91ZV4

Recommended name:2-acylglycerol O-acyltransferase 1

EC number:EC 2.3.1.22

Alternative names:(Acyl-CoA:monoacylglycerol acyltransferase 1) (MGAT1) (Diacylglycerol acyltransferase 2-like protein 1) (Monoacylglycerol O-acyltransferase 1)

Cleaved into:

GeneID:68393

Gene names  (primary ):Mogat1

Gene names  (synonym ):Dgat2l1

Gene names  (ORF ):

Length:335

Mass:38791

Sequence:MMVEFAPLNTPLARCLQTAAVLQWVLSFLLLVQVCIGIMVMLVLYNYWFLYIPYLVWFYYDWRTPEQGGRRWNWVQSWPVWKYFKEYFPICLVKTQDLDPGHNYIFGFHPHGIFVPGAFGNFCTKYSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGGGNVSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPKGSWLRTIQDAMYDSMGVALPLIYARGIFQHYFGIMPYRKLIYTVVGRPIPVQQTLNPTSEQIEELHQTYLEELKKLFNEHKGKYGIPEHETLVFK

Tissue specificity:Expressed at high level in kidney and stomach. Expressed at lower level in brown and white adipose tissue, uterus and liver. Not detected in small intestine. {ECO:0000269|PubMed:12077311}.

Induction:

Developmental stage:

Protein families:Diacylglycerol acyltransferase family


   💬 WhatsApp