ACOT9_MOUSE   Q9R0X4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R0X4

Recommended name:Acyl-coenzyme A thioesterase 9, mitochondrial

EC number:EC 3.1.2.-

Alternative names:(Acyl-CoA thioesterase 9) (Acyl coenzyme A thioester hydrolase 2) (MTE-2) (Acyl-CoA thioester hydrolase 9) (Mitochondrial 48 kDa acyl-CoA thioester hydrolase 1) (Mt-ACT48.1) (Protein U8) (p48)

Cleaved into:

GeneID:56360

Gene names  (primary ):Acot9

Gene names  (synonym ):Acate2

Gene names  (ORF ):

Length:439

Mass:50560

Sequence:MKRAAIRLWTLNKGLLTHGRGLSQGSQYKISEPLHIHQVRDKLREIVGVSTVWRDHVKAMEERKLLHSFLPKSQKVLPPRKMRDSYIEVLLPLGTDPELRDKYVTVQNTVRFGRILEDLDSLGVLVCYMHNHNHSTKMSPLSIVTVLVDKIDMCKHSLSPEQDIKFTGHVSWVGNTSMEVKMKMFQLHNDEKYWPVLDATFVMVARDSENKGPAFVNPLIPENKEEEELFKQGELNKSRRIAFSTSSLLKVAPSSEERNIIHELFLTTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQDNYIQVRVHSEVSSLDSREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHFKSMSTPVTLKKDYPVEP

Tissue specificity:

Induction:

Developmental stage:

Protein families:Acyl coenzyme A hydrolase family


   💬 WhatsApp