ACO13_MOUSE Q9CQR4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQR4
Recommended name：Acyl-coenzyme A thioesterase 13
EC number：EC 3.1.2.-
Alternative names：(Acyl-CoA thioesterase 13) (Hotdog-fold thioesterase superfamily member 2) (Palmitoyl-CoA hydrolase) (Thioesterase superfamily member 2) (THEM2)
Cleaved into：
GeneID：66834
Gene names (primary )：Acot13
Gene names (synonym )：Them2
Gene names (ORF )：
Length：140
Mass：15183
Sequence：MSSMTQNLREVMKVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKLGTLHGGLTATLVDSISTMALMCTERGAPGVSVDMNITYMSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGRHTKHLGN
Tissue specificity：Highly expressed in the kidney and moderately in the heart, liver, brain, small and large intestine. Also expressed in brown adipose tissue. {ECO:0000269|PubMed:17045243, ECO:0000269|PubMed:17704541, ECO:0000269|PubMed:19405909, ECO:0000269|PubMed:22345407}.
Induction：
Developmental stage：
Protein families：Thioesterase PaaI family