LNEBL_MOUSE   Q9DC07


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DC07

Recommended name:LIM zinc-binding domain-containing Nebulette

EC number:

Alternative names:(Actin-binding Z-disk protein)

Cleaved into:

GeneID:74103

Gene names  (primary ):Nebl

Gene names  (synonym ):Lnebl

Gene names  (ORF ):

Length:270

Mass:31113

Sequence:MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQSFTTVADTPENLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDDPVTERVRKSTQVVSDAAYKGVQPHVVEMDRRPGIIVAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQPPAHLRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp