F220A_MOUSE   Q3ZN08


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3ZN08

Recommended name:Protein FAM220A

EC number:

Alternative names:(Acrosomal protein ACPIN1) (STAT3-interacting protein as a repressor)

Cleaved into:

GeneID:67238

Gene names  (primary ):Fam220a

Gene names  (synonym ):Acpin1 Sipar

Gene names  (ORF ):

Length:260

Mass:27752

Sequence:MKAGRGTLGVCLAKQSQGGDPDKLACGLKKRSQKRNPSPSVVPSWTDQPVADSHGKSRATGAAASEMKHGQSKASLLHHGGFKVLQSLKGSVGRSSAPAASLGKAVALSPAPSEEQLAGMSHGIGDALGSDWPGREPRATDNRGQYLKGESWVSGRPGHPKLREVGFLRGEPPSAGPKGLGTWSELSHRYFELGQLPYAYPYYKVLPEGELRCVSLDRFNPGLSEETVEDEKTLKFFRWSADSRGVTGSAIFQISKSLMP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp