AN32A_MOUSE O35381
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35381
Recommended name：Acidic leucine-rich nuclear phosphoprotein 32 family member A
EC number：
Alternative names：(Acidic nuclear phosphoprotein pp32) (Leucine-rich acidic nuclear protein) (LANP) (Potent heat-stable protein phosphatase 2A inhibitor I1PP2A)
Cleaved into：
GeneID：11737
Gene names (primary )：Anp32a
Gene names (synonym )：Anp32 Lanp
Gene names (ORF )：
Length：247
Mass：28538
Sequence：MEMDKRIYLELRNRTPSDVKELVLDNCKSIEGKIEGLTDEFEELEFLSTINVGLTSISNLPKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEEDD
Tissue specificity：Predominantly expressed in the cerebellum. Expressed also in cortex, lung, skeletal muscle, gastrointestinal tract, spleen, liver and heart. {ECO:0000269|PubMed:15895553}.
Induction：
Developmental stage：
Protein families：ANP32 family